C20orf160 (CCM2L) Rabbit Polyclonal Antibody TA340238 from OriGene Technologies | Biocompare.com

Supplier Images

C20orf160 (CCM2L) Rabbit Polyclonal Antibody

Be the first to write a review!

Supplier Page from
OriGene Technologies for
C20orf160 (CCM2L) Rabbit Polyclonal Antibody

OriGene Technologies' C20orf160 (CCM2L) Rabbit Polyclonal Antibody is a Rabbit Polyclonal antibody. This antibody has been shown to work in applications such as: Western Blot. The C20orf160 (CCM2L) Rabbit Polyclonal Antibody was generated using CCM2L as the antigen and it reacts with Human.

Description

Rabbit Polyclonal Anti-CCM2L Antibody

Product Specs
ItemC20orf160 (CCM2L) Rabbit Polyclonal Antibody
CompanyOriGene Technologies
Price Pricing Info Supplier Page View Company Product Page
Catalog NumberTA340238
Quantity100 µl
ApplicationsWB
Concentrationlot specific
Conjugate/TagUnconjugated
PurityAffinity Purified
ReactivityHuman
TargetCCM2L
IsotypeIgG
HostRabbit
Antibody TypePrimary Antibodies
ImmunogenThe immunogen for anti-C20orf160 antibody: synthetic peptide directed towards the N terminal of human C20orf160. Synthetic peptide located within the following region: LTWVTSSLNPSSRDELLQLLDTARQLKELPLKTTAEQDSILSLSARCLLL
NCBI Full Gene NameCCM2 like scaffold protein
NCBI Gene AliasesdJ310O13.5, C20orf160
ClonalityPolyclonal
TypePrimary Antibodies
FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Note that this product is shipped as lyophilized powder to China customers.

Add to Compare List

OriGene Technologies

OriGene Technologies

9620 Medical Center Drive # 200

Rockville, Maryland 20850

United States

Phone: 1-888-267-4436 (U.S. only) / 301-340-3188
301-340-9254

Company Profile

Website: http://www.origene.com

Be the First to Write a Review!